Atlas Antibodies Anti-CASP6 Antibody

상품 한눈에 보기

Human CASP6 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 Rabbit IgG 항체이며, Orthogonal 및 Independent validation을 통해 검증됨. Apoptosis 관련 연구에 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA024303-100 Anti-CASP6 Antibody, caspase 6, apoptosis-related cysteine peptidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA024303-25 Anti-CASP6 Antibody, caspase 6, apoptosis-related cysteine peptidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

caspase 6, apoptosis-related cysteine peptidase

IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Independent validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC

Polyclonal Antibody against Human CASP6

MCH2

항목	내용
Target Protein	caspase 6, apoptosis-related cysteine peptidase
Target Gene	CASP6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQV
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000027997 (91%), Rat ENSRNOG00000052613 (91%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand