CacheBy
Atlas Antibodies Anti-CASC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CASC4 Antibody

상품 한눈에 보기

Human CASC4 단백질을 타깃으로 한 Rabbit Polyclonal 항체. IHC 및 ICC에 적합하며, 독립 항체 간 비교로 검증된 신뢰성 높은 제품. PrEST 항원을 이용해 친화 정제되었으며 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049488-100 Anti-CASC4 Antibody, cancer susceptibility candidate 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049488-25 Anti-CASC4 Antibody, cancer susceptibility candidate 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CASC4 Antibody

Anti-CASC4 Antibody

Target: Cancer Susceptibility Candidate 4 (CASC4)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Independent antibody validation
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human CASC4


Alternative Gene Names

  • DKFZp459F1927
  • H63

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Cancer susceptibility candidate 4
Target Gene CASC4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016357 (82%), Mouse ENSMUSG00000060227 (82%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.