
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CASC4 Antibody
상품 한눈에 보기
Human CASC4 단백질을 타깃으로 한 Rabbit Polyclonal 항체. IHC 및 ICC에 적합하며, 독립 항체 간 비교로 검증된 신뢰성 높은 제품. PrEST 항원을 이용해 친화 정제되었으며 PBS/glycerol buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049488-100 Anti-CASC4 Antibody, cancer susceptibility candidate 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049488-25 Anti-CASC4 Antibody, cancer susceptibility candidate 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CASC4 Antibody
Anti-CASC4 Antibody
Target: Cancer Susceptibility Candidate 4 (CASC4)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC) – Independent antibody validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human CASC4
Alternative Gene Names
- DKFZp459F1927
- H63
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cancer susceptibility candidate 4 |
| Target Gene | CASC4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016357 (82%), Mouse ENSMUSG00000060227 (82%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



