Atlas Antibodies Anti-CASC4 Antibody

상품 한눈에 보기

Human CASC4 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 독립 항체 간 비교로 검증된 신뢰성 높은 제품이며, 토끼 유래 IgG 형식으로 PrEST 항원으로 정제되었습니다. Human에 반응하며 40% 글리세롤 기반 완충액에 보존됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043015-100 Anti-CASC4 Antibody, cancer susceptibility candidate 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043015-25 Anti-CASC4 Antibody, cancer susceptibility candidate 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CASC4 Antibody

Anti-CASC4 Antibody

Target: cancer susceptibility candidate 4 (CASC4)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry) – Independent antibody validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human CASC4.

Alternative Gene Names

DKFZp459F1927
H63

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	cancer susceptibility candidate 4
Target Gene	CASC4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NTYLVKRLEYESFQCGQQMKELRAQHEENIKKLADQFLEEQKQETQKIQSNDGKELDINNQVVPKNIPKVAENVADKNE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000060227 (82%)
Rat ENSRNOG00000016357 (82%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand