CacheBy
Atlas Antibodies Anti-CASC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CASC3 Antibody

상품 한눈에 보기

인간 CASC3 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit에서 생산된 IgG 형식의 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 특이적으로 검증되었으며, 관련 종과의 높은 서열 유사성을 보입니다.

카탈로그번호
HPA050262-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050262-100 Anti-CASC3 Antibody, cancer susceptibility candidate 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050262-25 Anti-CASC3 Antibody, cancer susceptibility candidate 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CASC3 Antibody

Anti-CASC3 Antibody

Target: cancer susceptibility candidate 3 (CASC3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human CASC3 protein.


Alternative Gene Names

  • BTZ
  • MLN51

Open Datasheet


Target Information

항목 내용
Target Protein cancer susceptibility candidate 3
Target Gene CASC3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKLAEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLN

Species Reactivity

항목 내용
Verified Species Human
Interspecies Information Highest antigen sequence identity to orthologs: Rat (81%), Mouse (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.