AI 생성

1 / 2

Atlas Antibodies Anti-CANX Antibody

상품 한눈에 보기

Human calnexin을 타겟으로 하는 rabbit polyclonal antibody로, IHC 및 ICC 응용에 적합. 독립적 항체 검증을 통해 높은 신뢰성 확보. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA009433-100 Anti-CANX Antibody, calnexin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA009433-25 Anti-CANX Antibody, calnexin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: calnexin
Supplier: Atlas Antibodies

IHC (Independent validation by comparing antibodies targeting different epitopes)
ICC

Polyclonal antibody against human CANX.

CNX, IP90, P90

항목	내용
Target Protein	calnexin
Target Gene	CANX
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat (89%, ENSRNOG00000003343), Mouse (88%, ENSMUSG00000020368)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI

Enhanced Validation
IHC Independent Validation
ICC Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.