CacheBy
Atlas Antibodies Anti-CANT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CANT1 Antibody

상품 한눈에 보기

Human CANT1 단백질을 인식하는 Rabbit Polyclonal 항체로, Orthogonal validation을 통해 검증됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA022818-100 Anti-CANT1 Antibody, calcium activated nucleotidase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022818-25 Anti-CANT1 Antibody, calcium activated nucleotidase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CANT1 Antibody

Anti-CANT1 Antibody

Target: calcium activated nucleotidase 1 (CANT1)
Type: Polyclonal Antibody against Human CANT1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Rabbit polyclonal antibody targeting human CANT1 (calcium activated nucleotidase 1).
Validated through orthogonal comparison to RNA-seq data.


Alternative Gene Names

  • SCAN-1
  • SHAPY

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein calcium activated nucleotidase 1
Target Gene CANT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVK
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003239 (86%), Mouse ENSMUSG00000025575 (82%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet MSDS - Sodium Azide

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.