
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CAND1 Antibody
상품 한눈에 보기
인간 CAND1 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 동일성을 보입니다. 40% 글리세롤/PBS 버퍼에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055748-100 Anti-CAND1 Antibody, cullin-associated and neddylation-dissociated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055748-25 Anti-CAND1 Antibody, cullin-associated and neddylation-dissociated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CAND1 Antibody
Anti-CAND1 Antibody
Target: cullin-associated and neddylation-dissociated 1
Supplier: Atlas Antibodies
Recommended Applications
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CAND1
Alternative Gene Names
DKFZp434M1414, KIAA0829, TIP120, TIP120A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cullin-associated and neddylation-dissociated 1 |
| Target Gene | CAND1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000007834 (100%) Mouse ENSMUSG00000020114 (100%) |
Antigen Sequence:
DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



