CacheBy
Atlas Antibodies Anti-CAND1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAND1 Antibody

상품 한눈에 보기

인간 CAND1 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 동일성을 보입니다. 40% 글리세롤/PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055748-100 Anti-CAND1 Antibody, cullin-associated and neddylation-dissociated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055748-25 Anti-CAND1 Antibody, cullin-associated and neddylation-dissociated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAND1 Antibody

Anti-CAND1 Antibody

Target: cullin-associated and neddylation-dissociated 1
Supplier: Atlas Antibodies


  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CAND1


Alternative Gene Names

DKFZp434M1414, KIAA0829, TIP120, TIP120A

Open Datasheet


Target Information

항목 내용
Target Protein cullin-associated and neddylation-dissociated 1
Target Gene CAND1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000007834 (100%)
Mouse ENSMUSG00000020114 (100%)

Antigen Sequence:
DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.