Atlas Antibodies Anti-CAND1 Antibody

상품 한눈에 보기

Human CAND1 단백질을 인식하는 rabbit polyclonal antibody로, WB 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 항원 일치율을 보입니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069053-100 Anti-CAND1 Antibody, cullin-associated and neddylation-dissociated 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069053-25 Anti-CAND1 Antibody, cullin-associated and neddylation-dissociated 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CAND1 Antibody

Anti-CAND1 Antibody

Target: cullin-associated and neddylation-dissociated 1 (CAND1)
Supplier: Atlas Antibodies

Recommended Applications

WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human CAND1

Alternative Gene Names

DKFZp434M1414, KIAA0829, TIP120, TIP120A

Open Datasheet

Target Information

항목	내용
Target Protein	cullin-associated and neddylation-dissociated 1
Target Gene	CAND1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCT
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000007834 (100%) Mouse ENSMUSG00000020114 (100%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand