CacheBy
Atlas Antibodies Anti-CAND2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAND2 Antibody

상품 한눈에 보기

Human CAND2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Mouse 및 Rat과 89% 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA005777-100 Anti-CAND2 Antibody, cullin-associated and neddylation-dissociated 2 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005777-25 Anti-CAND2 Antibody, cullin-associated and neddylation-dissociated 2 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAND2 Antibody

Anti-CAND2 Antibody

Target: cullin-associated and neddylation-dissociated 2 (putative)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CAND2.

Alternative Gene Names: KIAA0667, TIP120B, Tp120b
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cullin-associated and neddylation-dissociated 2 (putative)
Target Gene CAND2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MPVLVSGIIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAEALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGH

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000030319 (89%), Rat ENSRNOG00000010473 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.