CacheBy
Atlas Antibodies Anti-CAMSAP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAMSAP2 Antibody

상품 한눈에 보기

Human CAMSAP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. 인간에서 검증되었고, 마우스 및 랫과도 높은 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027302-100 Anti-CAMSAP2 Antibody, calmodulin regulated spectrin-associated protein family, member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027302-25 Anti-CAMSAP2 Antibody, calmodulin regulated spectrin-associated protein family, member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAMSAP2 Antibody

Anti-CAMSAP2 Antibody

Target: calmodulin regulated spectrin-associated protein family, member 2 (CAMSAP2)
Supplier: Atlas Antibodies


  • Independent antibody validation in IHC
    Validation of protein expression in immunohistochemistry (IHC) by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human CAMSAP2.


Alternative Gene Names

CAMSAP1L1, KIAA1078

Open Datasheet


Specifications

항목 내용
Target Protein calmodulin regulated spectrin-associated protein family, member 2
Target Gene CAMSAP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
SSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSHVSKHIRKNLSFKPINGEEEAESIEEELNIDSHSDLKSCVPL
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000041570 (81%)
Rat ENSRNOG00000008741 (77%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative.
Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.