CacheBy
Atlas Antibodies Anti-CAMTA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAMTA2 Antibody

상품 한눈에 보기

Human CAMTA2 단백질을 표적으로 하는 rabbit polyclonal antibody로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 affinity purification으로 높은 특이성과 재현성을 제공합니다. Human에 대한 검증된 반응성을 보유합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027835-100 Anti-CAMTA2 Antibody, calmodulin binding transcription activator 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027835-25 Anti-CAMTA2 Antibody, calmodulin binding transcription activator 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAMTA2 Antibody

Anti-CAMTA2 Antibody

Target: calmodulin binding transcription activator 2
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CAMTA2

Alternative Gene Names

  • KIAA0909

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein calmodulin binding transcription activator 2
Target Gene CAMTA2
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000004283 (87%), Mouse ENSMUSG00000040712 (85%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEF

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.