CacheBy
Atlas Antibodies Anti-CAMSAP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAMSAP3 Antibody

상품 한눈에 보기

Human CAMSAP3 단백질을 인식하는 토끼 폴리클로날 항체. IHC를 통한 단백질 발현 정량에 적합하며 RNA-seq 데이터와의 직교 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 조직 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043830-100 Anti-CAMSAP3 Antibody, calmodulin regulated spectrin-associated protein family, member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043830-25 Anti-CAMSAP3 Antibody, calmodulin regulated spectrin-associated protein family, member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAMSAP3 Antibody

Anti-CAMSAP3 Antibody

Target: calmodulin regulated spectrin-associated protein family, member 3 (CAMSAP3)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human CAMSAP3.


Alternative Gene Names

KIAA1543, Nezha, PPP1R80

Open Datasheet


Target Information

항목 내용
Target Protein calmodulin regulated spectrin-associated protein family, member 3
Target Gene CAMSAP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LRHQPILMGAHLAVIDALMAAFAFEWTKTLPGPLALTSLEHKLLFWVDTTVRRLQEKTEQEAAQRASPAAPADGAAPAQPSIRYRKDR
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000044433 (93%), Rat ENSRNOG00000000986 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Application IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.