AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CACNG5 Antibody
상품 한눈에 보기
인간 CACNG5 단백질을 인식하는 폴리클로날 항체로, 전압의존성 칼슘 채널 감마 서브유닛 연구에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. IHC 등 다양한 응용에 사용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050115-100 Anti-CACNG5 Antibody, calcium channel, voltage-dependent, gamma subunit 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050115-25 Anti-CACNG5 Antibody, calcium channel, voltage-dependent, gamma subunit 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CACNG5 Antibody
Anti-CACNG5 Antibody
Target: Calcium channel, voltage-dependent, gamma subunit 5
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human CACNG5 protein.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Calcium channel, voltage-dependent, gamma subunit 5 |
| Target Gene | CACNG5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: WRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRS |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000040373 (95%) Rat ENSRNOG00000003288 (95%) |
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.