Atlas Antibodies Anti-CACNG4 Antibody

상품 한눈에 보기

인간 CACNG4 단백질을 표적으로 하는 폴리클로날 항체. 정제된 PrEST 항원 기반 친화 정제. IHC 및 RNA-seq 비교를 통한 직교 검증 완료. 토끼 유래 IgG로 사람, 쥐, 생쥐 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA005803-100 Anti-CACNG4 Antibody, calcium channel, voltage-dependent, gamma subunit 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA005803-25 Anti-CACNG4 Antibody, calcium channel, voltage-dependent, gamma subunit 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: calcium channel, voltage-dependent, gamma subunit 4
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human CACNG4

MGC11138, MGC24983

항목	내용
Target Protein	calcium channel, voltage-dependent, gamma subunit 4
Target Gene	CACNG4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000003262 (100%), Mouse ENSMUSG00000020723 (99%)

Antigen Sequence:
TDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSV

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand