CacheBy
Atlas Antibodies Anti-CACNG3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CACNG3 Antibody

상품 한눈에 보기

Human CACNG3 단백질을 타깃으로 하는 토끼 폴리클로날 항체. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보. IHC 등 다양한 연구 응용에 적합. PBS/glycerol buffer에 보존된 안정한 포맷.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059010-100 Anti-CACNG3 Antibody, calcium channel, voltage-dependent, gamma subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059010-25 Anti-CACNG3 Antibody, calcium channel, voltage-dependent, gamma subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CACNG3 Antibody

Anti-CACNG3 Antibody

Target: Calcium channel, voltage-dependent, gamma subunit 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human CACNG3.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Calcium channel, voltage-dependent, gamma subunit 3
Target Gene CACNG3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012362 (97%), Mouse ENSMUSG00000066189 (97%)

Antigen Sequence:
PSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPAN


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.