CacheBy
Atlas Antibodies Anti-CACNA1H Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CACNA1H Antibody

상품 한눈에 보기

인간 CACNA1H 단백질을 인식하는 토끼 폴리클로날 항체. T형 전압 의존성 칼슘 채널 α1H 서브유닛 검출용. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 사람에 특이적으로 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039125-100 Anti-CACNA1H Antibody, calcium channel, voltage-dependent, T type, alpha 1H subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039125-25 Anti-CACNA1H Antibody, calcium channel, voltage-dependent, T type, alpha 1H subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CACNA1H Antibody

Anti-CACNA1H Antibody

Target: calcium channel, voltage-dependent, T type, alpha 1H subunit
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CACNA1H (Cav3.2).


Alternative Gene Names

  • Cav3.2

Target Information

항목 내용
Target Protein calcium channel, voltage-dependent, T type, alpha 1H subunit
Target Gene CACNA1H
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP
Verified Species Reactivity Human
Interspecies Identity Mouse (62%), Rat (61%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.