CacheBy
Atlas Antibodies Anti-CA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CA3 Antibody

상품 한눈에 보기

Human CA3 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB 검증 완료. 근육 특이적 carbonic anhydrase III 검출에 적합. 고순도 Affinity purification 방식으로 제조. 사람, 쥐, 랫트 간 교차 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021775-100 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021775-25 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CA3 Antibody

Anti-CA3 Antibody

Target: carbonic anhydrase III, muscle specific


  • IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 검증
  • WB (Independent validation): 서로 다른 epitope을 인식하는 독립 항체 간 발현 비교를 통한 단백질 발현 검증

Product Description

Polyclonal antibody against Human CA3 (carbonic anhydrase III, muscle specific)


Alternative Gene Names

CAIII, Car3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein carbonic anhydrase III, muscle specific
Target Gene CA3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYR

Verified Species Reactivity

Human


Interspecies Information

Ortholog ID Sequence Identity
Rat ENSRNOG00000010079 89%
Mouse ENSMUSG00000027559 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.