
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CA3 Antibody
상품 한눈에 보기
Human CA3 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB 검증 완료. 근육 특이적 carbonic anhydrase III 검출에 적합. 고순도 Affinity purification 방식으로 제조. 사람, 쥐, 랫트 간 교차 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021775-100 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021775-25 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CA3 Antibody
Anti-CA3 Antibody
Target: carbonic anhydrase III, muscle specific
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 검증
- WB (Independent validation): 서로 다른 epitope을 인식하는 독립 항체 간 발현 비교를 통한 단백질 발현 검증
Product Description
Polyclonal antibody against Human CA3 (carbonic anhydrase III, muscle specific)
Alternative Gene Names
CAIII, Car3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | carbonic anhydrase III, muscle specific |
| Target Gene | CA3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYR |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000010079 | 89% |
| Mouse | ENSMUSG00000027559 | 89% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



