
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CA3 Antibody
상품 한눈에 보기
Human CA3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. 근육 특이적 carbonic anhydrase III 단백질 검출에 적합. 고순도의 Affinity 정제 항체로 다양한 연구 응용에 활용 가능.
- 카탈로그번호
- HPA026700-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026700-100 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026700-25 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CA3 Antibody
Anti-CA3 Antibody
Target: carbonic anhydrase III, muscle specific
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저발현 조직에서 검증
- Independent antibody validation (WB): 서로 다른 epitope을 인식하는 항체 간 단백질 발현 비교를 통해 검증
Product Description
- Type: Polyclonal Antibody
- Species Reactivity: Human
- Alternative Gene Names: CAIII, Car3
- Host: Rabbit
- Isotype: IgG
- Target Gene: CA3
- Target Protein: carbonic anhydrase III, muscle specific
- Antigen Sequence:
DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYR
(Recombinant Protein Epitope Signature Tag, PrEST)
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000027559 | 89% |
| Rat | ENSRNOG00000010079 | 89% |
Purification and Buffer Information
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



