CacheBy
Atlas Antibodies Anti-CA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CA3 Antibody

상품 한눈에 보기

Human CA3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. 근육 특이적 carbonic anhydrase III 단백질 검출에 적합. 고순도의 Affinity 정제 항체로 다양한 연구 응용에 활용 가능.

카탈로그번호
HPA026700-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026700-100 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026700-25 Anti-CA3 Antibody, carbonic anhydrase III, muscle specific 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CA3 Antibody

Anti-CA3 Antibody

Target: carbonic anhydrase III, muscle specific
Supplier: Atlas Antibodies


  • Orthogonal validation (IHC): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저발현 조직에서 검증
  • Independent antibody validation (WB): 서로 다른 epitope을 인식하는 항체 간 단백질 발현 비교를 통해 검증

Product Description

  • Type: Polyclonal Antibody
  • Species Reactivity: Human
  • Alternative Gene Names: CAIII, Car3
  • Host: Rabbit
  • Isotype: IgG
  • Target Gene: CA3
  • Target Protein: carbonic anhydrase III, muscle specific
  • Antigen Sequence:
    DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYR
    (Recombinant Protein Epitope Signature Tag, PrEST)

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000027559 89%
Rat ENSRNOG00000010079 89%

Purification and Buffer Information

항목 내용
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Independent Validation
Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.