CacheBy
Atlas Antibodies Anti-CA10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CA10 Antibody

상품 한눈에 보기

Human CA10 단백질을 타겟으로 한 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성을 보이며, 안정적인 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057837-100 Anti-CA10 Antibody, carbonic anhydrase X 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057837-25 Anti-CA10 Antibody, carbonic anhydrase X 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CA10 Antibody

Anti-CA10 Antibody

Target: Carbonic anhydrase X (CA10)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CA10, also known as carbonic anhydrase X.

Alternative Gene Names

CA-RPX, CARPX, HUCEP-15

Immunohistochemistry (IHC)

Target Information

  • Target Protein: Carbonic anhydrase X
  • Target Gene: CA10

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000002626 100%
Mouse ENSMUSG00000056158 100%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.