CacheBy
Atlas Antibodies Anti-C7orf43 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C7orf43 Antibody

상품 한눈에 보기

Human C7orf43 단백질을 인식하는 폴리클론 토끼 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간, 마우스, 랫트에서 반응 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029464-100 Anti-C7orf43 Antibody, chromosome 7 open reading frame 43 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029464-25 Anti-C7orf43 Antibody, chromosome 7 open reading frame 43 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C7orf43 Antibody

Anti-C7orf43 Antibody

Target: Chromosome 7 open reading frame 43 (C7orf43)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C7orf43.

Alternative Gene Names

  • FLJ10925

Open Datasheet (PDF)

Target Information

  • Target Protein: Chromosome 7 open reading frame 43
  • Target Gene: C7orf43

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSSPAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDKAVLSLDKIAKRECKVLVVE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000036948 (100%)
  • Rat ENSRNOG00000039214 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.