CacheBy
Atlas Antibodies Anti-C2orf68 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf68 Antibody

상품 한눈에 보기

Human C2orf68 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit에서 생산되었으며 IgG 아이소타입을 가지며, PrEST 항원으로 친화 정제되었습니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051143-100 Anti-C2orf68 Antibody, chromosome 2 open reading frame 68 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051143-25 Anti-C2orf68 Antibody, chromosome 2 open reading frame 68 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf68 Antibody

Anti-C2orf68 Antibody

Target: chromosome 2 open reading frame 68 (C2orf68)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C2orf68.
Open Datasheet


Target Information

  • Target Protein: chromosome 2 open reading frame 68
  • Target Gene: C2orf68
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSGGSELEPSGHQLFCLEYEADSGEVTSVIVYQGDDPGKVSEKVSAHTPLDPPMREALKLRIQEEIAKRQSQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000011713 86%
Mouse ENSMUSG00000108680 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.