Thermo Fisher Scientific PHD3 Polyclonal Antibody
PHD3 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, WB 및 IHC(P) 실험에 사용됩니다. 합성 펩타이드를 면역원으로 하며, 동결건조 형태로 제공됩니다. 세포의 산소 감지 및 HIF 단백질 연구에 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PHD3 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human PHD3 |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746305 |
Product Specific Information
The synthetic peptide sequence is:
ATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Add 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PHD3는 세포 내 산소 센서로 작용하며, 정상 산소 조건에서 hypoxia-inducible factor (HIF) α 단백질의 특정 프롤린 잔기를 하이드록실화하여 4-hydroxyproline을 형성합니다. 이 반응은 HIF1A 및 HIF2A의 산소 의존적 분해 도메인(ODD) 내 특정 부위에서 일어나며, 하이드록실화된 HIF는 von Hippel-Lindau 유비퀴틴화 복합체를 통해 프로테아좀 분해로 유도됩니다. 저산소 조건에서는 이 반응이 억제되어 HIF가 핵으로 이동하고, HIF1B와 이합체를 형성하여 저산소 유도 유전자의 발현을 증가시킵니다. 또한 EGLN3는 심근세포 및 신경세포의 세포사멸 조절, DNA 손상 반응(DDR), 염증 반응 조절 등 다양한 생리적 기능에 관여합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.