
1 / 2
Atlas Antibodies Anti-POLR3E Antibody
상품 한눈에 보기
Human POLR3E 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고글리세롤 PBS 버퍼에 안정화되어 있습니다. 인간에서 검증되었으며 마우스 및 랫과 높은 상동성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR3E Antibody
Target: polymerase (RNA) III (DNA directed) polypeptide E (80kD)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Western Blot): Independent antibody validation – comparison of antibodies targeting different epitopes of the same protein
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human POLR3E.
Alternative Gene Names
FLJ10509, RPC5, SIN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) III (DNA directed) polypeptide E (80kD) |
| Target Gene | POLR3E |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDK |
Species Reactivity
- Verified: Human
- Interspecies Identity:
- Mouse (ENSMUSG00000030880): 99%
- Rat (ENSRNOG00000016960): 98%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLRMT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3K Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3GL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3G Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.