
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-POLR3E Antibody
상품 한눈에 보기
Human POLR3E 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고글리세롤 PBS 버퍼에 안정화되어 있습니다. 인간에서 검증되었으며 마우스 및 랫과 높은 상동성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041477-100 Anti-POLR3E Antibody, polymerase (RNA) III (DNA directed) polypeptide E (80kD) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041477-25 Anti-POLR3E Antibody, polymerase (RNA) III (DNA directed) polypeptide E (80kD) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-POLR3E Antibody
Anti-POLR3E Antibody
Target: polymerase (RNA) III (DNA directed) polypeptide E (80kD)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Western Blot): Independent antibody validation – comparison of antibodies targeting different epitopes of the same protein
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human POLR3E.
Alternative Gene Names
FLJ10509, RPC5, SIN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) III (DNA directed) polypeptide E (80kD) |
| Target Gene | POLR3E |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDK |
Species Reactivity
- Verified: Human
- Interspecies Identity:
- Mouse (ENSMUSG00000030880): 99%
- Rat (ENSRNOG00000016960): 98%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



