
1 / 2
Atlas Antibodies Anti-POLR3K Antibody
상품 한눈에 보기
Human POLR3K 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 재조합 발현 검증을 통해 신뢰성을 확보했습니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR3K Antibody
Target: polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, recombinant expression validation)
Recombinant expression validation: WB에서 표적 단백질 과발현을 이용한 검증 수행
Product Description
Polyclonal antibody against human POLR3K
Alternative Gene Names
- RPC11
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa |
| Target Gene | POLR3K |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000017843 (99%), Mouse ENSMUSG00000038628 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 조건은 사용자가 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POM121 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLRMT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3K Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3GL Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.