
1 / 2
Atlas Antibodies Anti-POLR3G Antibody
상품 한눈에 보기
Human POLR3G 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 고순도의 재현성 있는 결과 제공. PBS와 glycerol 기반 buffer에 보존제 첨가.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR3G Antibody
Target: polymerase (RNA) III (DNA directed) polypeptide G (32kD)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human POLR3G.
Alternative Gene Names
- RPC32
- RPC7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) III (DNA directed) polypeptide G (32kD) |
| Target Gene | POLR3G |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016260 (90%), Mouse ENSMUSG00000035834 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLR3E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3GL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3G Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3F Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.