Atlas Antibodies Anti-PLCH1 Antibody

상품 한눈에 보기

인간 PLCH1 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 글리세롤 및 PBS 완충액에 보존되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036176-100 Anti-PLCH1 Antibody, phospholipase C, eta 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036176-25 Anti-PLCH1 Antibody, phospholipase C, eta 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: phospholipase C, eta 1 (PLCH1)
Type: Polyclonal Antibody against Human PLCH1

Polyclonal antibody raised in rabbit against human PLCH1 (phospholipase C, eta 1).

DKFZp434C1372, KIAA1069, MGC117152, PLCeta1, PLCL3

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SLTTCEYRREGTSQLASPLKLKYNQGVVEHFQRGLRNGYCKETLRPSVPEIFNNIQDVKTQSISYLAYQGAGFVHNHFSDSDAKMFQTCVPQQS

Verified Reactivity: Human
Interspecies Identity:
- Mouse (ENSMUSG00000036834): 71%
- Rat (ENSRNOG00000009955): 68%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.