CacheBy
Atlas Antibodies Anti-PLCG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLCG2 Antibody

상품 한눈에 보기

Human PLCG2 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 신뢰성 높은 검증 데이터를 제공. Human, Mouse, Rat 종에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020100-100 Anti-PLCG2 Antibody, phospholipase C, gamma 2 (phosphatidylinositol-specific) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020100-25 Anti-PLCG2 Antibody, phospholipase C, gamma 2 (phosphatidylinositol-specific) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLCG2 Antibody

Anti-PLCG2 Antibody

phospholipase C, gamma 2 (phosphatidylinositol-specific)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent Antibody Validation)
  • ICC (Immunocytochemistry)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PLCG2

Open Datasheet


Target Information

항목 내용
Target Protein phospholipase C, gamma 2 (phosphatidylinositol-specific)
Target Gene PLCG2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPF
Verified Species Reactivity Human
Interspecies Identity Mouse (96%), Rat (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative.
Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.