CacheBy
Atlas Antibodies Anti-PLCG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLCG2 Antibody

상품 한눈에 보기

Human PLCG2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간 및 설치류 간 96% 이상의 항원 서열 동일성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020099-100 Anti-PLCG2 Antibody, phospholipase C, gamma 2 (phosphatidylinositol-specific) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020099-25 Anti-PLCG2 Antibody, phospholipase C, gamma 2 (phosphatidylinositol-specific) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLCG2 Antibody

Anti-PLCG2 Antibody

Target: phospholipase C, gamma 2 (phosphatidylinositol-specific)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human PLCG2

Open Datasheet


Target Information

항목 내용
Target Protein phospholipase C, gamma 2 (phosphatidylinositol-specific)
Target Gene PLCG2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPF
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000051986 (96%), Mouse ENSMUSG00000034330 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.