CacheBy
Atlas Antibodies Anti-PLA1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLA1A Antibody

상품 한눈에 보기

인간 PLA1A 단백질을 인식하는 토끼 폴리클로날 항체. 면역세포화학(ICC) 등 다양한 응용에 적합. 고순도의 PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 보유. 보존용으로 글리세롤과 아지드가 포함된 PBS 버퍼에 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059740-100 Anti-PLA1A Antibody, phospholipase A1 member A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059740-25 Anti-PLA1A Antibody, phospholipase A1 member A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLA1A Antibody

Anti-PLA1A Antibody

Target Information

  • Target Protein: phospholipase A1 member A
  • Target Gene: PLA1A
  • Alternative Gene Names: ps-PLA1
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PLA1A.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000002847 (71%)
  • Rat ENSRNOG00000057153 (68%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.