CacheBy
Atlas Antibodies Anti-PGD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGD Antibody

상품 한눈에 보기

Human PGD 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간과 마우스에서 검증되었습니다. 40% 글리세롤 기반 완충액에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031314-100 Anti-PGD Antibody, phosphogluconate dehydrogenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031314-25 Anti-PGD Antibody, phosphogluconate dehydrogenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGD Antibody

Anti-PGD Antibody

Target Protein: phosphogluconate dehydrogenase (PGD)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 검증
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human PGD.
Validated for use in multiple species and applications.

Open Datasheet


Specifications

항목 내용
Target Protein phosphogluconate dehydrogenase
Target Gene PGD
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGS
Verified Species Reactivity Human, Mouse
Interspecies Information Mouse ENSMUSG00000028961 (98%), Rat ENSRNOG00000057626 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.