CacheBy
Atlas Antibodies Anti-PECR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PECR Antibody

상품 한눈에 보기

Human PECR 단백질을 타깃으로 한 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. Recombinant expression 및 independent antibody 검증 완료. 높은 특이성과 재현성을 제공.

카탈로그번호
HPA021593-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021593-100 Anti-PECR Antibody, peroxisomal trans-2-enoyl-CoA reductase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021593-25 Anti-PECR Antibody, peroxisomal trans-2-enoyl-CoA reductase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PECR Antibody

Anti-PECR Antibody

Target: peroxisomal trans-2-enoyl-CoA reductase (PECR)
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human PECR.


Alternative Gene Names

HSA250303, SDR29C1, TERP


Target Information

항목 내용
Target Protein peroxisomal trans-2-enoyl-CoA reductase
Target Gene PECR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence (AA) IRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL
Verified Species Reactivity Human
Interspecies Information Mouse (72% identity, ENSMUSG00000026189), Rat (63% identity, ENSRNOG00000055295)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Recombinant Expression Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.