CacheBy
Atlas Antibodies Anti-PEF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PEF1 Antibody

상품 한눈에 보기

Human PEF1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% glycerol 기반 PBS buffer에 보존 처리됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061608-100 Anti-PEF1 Antibody, penta-EF-hand domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061608-25 Anti-PEF1 Antibody, penta-EF-hand domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PEF1 Antibody

Anti-PEF1 Antibody

Target: penta-EF-hand domain containing 1 (PEF1)
Type: Polyclonal Antibody against Human PEF1


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This is a rabbit polyclonal antibody targeting the human PEF1 protein, purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • PEF1A

Target Information

  • Target Protein: penta-EF-hand domain containing 1
  • Target Gene: PEF1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAA

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000028779 69%
Rat ENSRNOG00000013972 68%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.