CacheBy
Atlas Antibodies Anti-PECAM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PECAM1 Antibody

상품 한눈에 보기

Human PECAM1을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합. PrEST 항원을 사용해 Affinity Purification 수행. 40% 글리세롤 및 PBS 버퍼에 보존되며, 인간 단백질에 검증된 반응성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004690-100 Anti-PECAM1 Antibody, platelet/endothelial cell adhesion molecule 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004690-25 Anti-PECAM1 Antibody, platelet/endothelial cell adhesion molecule 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PECAM1 Antibody

Anti-PECAM1 Antibody

Target: Platelet/Endothelial Cell Adhesion Molecule 1 (PECAM1)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human PECAM1, produced in rabbit and affinity purified using the PrEST antigen as the affinity ligand.

Open Datasheet

Target Information

항목 내용
Target Protein Platelet/Endothelial Cell Adhesion Molecule 1
Target Gene PECAM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence APPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFEVIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000020717 58%
Rat ENSRNOG00000034230 23%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.