CacheBy
Atlas Antibodies Anti-C2orf40 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf40 Antibody

상품 한눈에 보기

인간 C2orf40 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현) 검증 완료. ECRG4(augurin) 대체명으로 알려진 유전자 타깃. PrEST 항원을 이용한 친화 정제. 인간 반응성 검증 완료.

카탈로그번호
HPA008546-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008546-100 Anti-C2orf40 Antibody, chromosome 2 open reading frame 40 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008546-25 Anti-C2orf40 Antibody, chromosome 2 open reading frame 40 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf40 Antibody

Anti-C2orf40 Antibody

chromosome 2 open reading frame 40


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human C2orf40.


Alternative Gene Names

  • augurin
  • ECRG4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 2 open reading frame 40
Target Gene C2orf40
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000023576 85%
Mouse ENSMUSG00000026051 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.