Atlas Antibodies Anti-C2orf16 Antibody

상품 한눈에 보기

Human C2orf16 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, glycerol 기반 PBS buffer로 안정화되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA052136-100 Anti-C2orf16 Antibody, chromosome 2 open reading frame 16 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA052136-25 Anti-C2orf16 Antibody, chromosome 2 open reading frame 16 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C2orf16 Antibody

Anti-C2orf16 Antibody

Target: chromosome 2 open reading frame 16 (C2orf16)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)

chromosome 2 open reading frame 16

Product Description

Polyclonal antibody against Human C2orf16.

Alternative Gene Names

DKFZp434G118

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	chromosome 2 open reading frame 16
Target Gene	C2orf16
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	LFGIPAELMEPSQSLPEKGPVTISQPSVVKNYIQRHTFYHGHKKRMALRIWTRGSTSSIIQQYSGTRVRIKKTNSTFNGISQEVIQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000049398	70%
Mouse	ENSMUSG00000044581	67%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)