CacheBy
Atlas Antibodies Anti-C20orf24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C20orf24 Antibody

상품 한눈에 보기

Human C20orf24 단백질을 타깃으로 하는 폴리클로날 항체입니다. Rabbit에서 생산된 IgG 형식으로 Affinity 정제되었습니다. IHC 및 ICC 응용에 적합하며, 높은 종간 항원 서열 유사성을 보입니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057387-100 Anti-C20orf24 Antibody, chromosome 20 open reading frame 24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057387-25 Anti-C20orf24 Antibody, chromosome 20 open reading frame 24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C20orf24 Antibody

Anti-C20orf24 Antibody

Target: Chromosome 20 open reading frame 24 (C20orf24)
Type: Polyclonal Antibody against Human C20orf24
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Alternative Gene Names

  • PNAS-11
  • RIP5

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000027637 97%
Rat ENSRNOG00000020317 97%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.