CacheBy
Atlas Antibodies Anti-C20orf85 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C20orf85 Antibody

상품 한눈에 보기

사람 C20orf85 단백질을 인식하는 토끼 폴리클로날 항체. IHC 기반 오쏘고날 검증 수행. PrEST 항원을 이용한 친화정제 방식. 인체 시료에 적합하며 RNA-seq 데이터와의 비교로 단백질 발현 검증 가능.

카탈로그번호
HPA058271-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058271-100 Anti-C20orf85 Antibody, chromosome 20 open reading frame 85 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058271-25 Anti-C20orf85 Antibody, chromosome 20 open reading frame 85 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C20orf85 Antibody

Anti-C20orf85 Antibody

Target: chromosome 20 open reading frame 85 (C20orf85)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C20orf85.


Alternative Gene Names

bA196N14.1, LLC1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 20 open reading frame 85
Target Gene C20orf85
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000027518 (75%), Rat ENSRNOG00000028533 (75%)

Antigen Sequence:

MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPTPKPKIELPERF

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Application - IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.