CacheBy
Atlas Antibodies Anti-C20orf194 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C20orf194 Antibody

상품 한눈에 보기

Human C20orf194 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대해 검증되었으며, 높은 종간 보존성을 보입니다.

카탈로그번호
HPA067418-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067418-100 Anti-C20orf194 Antibody, chromosome 20 open reading frame 194 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067418-25 Anti-C20orf194 Antibody, chromosome 20 open reading frame 194 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C20orf194 Antibody

Anti-C20orf194 Antibody

Target: chromosome 20 open reading frame 194 (C20orf194)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C20orf194 protein.


Alternative Gene Names

  • DKFZp434N061

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 20 open reading frame 194
Target Gene C20orf194
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LYCNPVNFRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKITSFVDMVRDCSRIGIPYSSQGHLQIFDMFVVEKWPIVQAFALEGIGGDGFFTMKYELQDVSLN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000021237 (98%)
  • Mouse ENSMUSG00000027309 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.