CacheBy
Atlas Antibodies Anti-C20orf194 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C20orf194 Antibody

상품 한눈에 보기

Human C20orf194 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 사용해 Affinity 정제되었으며, Human에 대한 반응성이 검증되었습니다. 안정화 용액 포함으로 장기 보관에 용이합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052103-100 Anti-C20orf194 Antibody, chromosome 20 open reading frame 194 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052103-25 Anti-C20orf194 Antibody, chromosome 20 open reading frame 194 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C20orf194 Antibody

Anti-C20orf194 Antibody

Target: chromosome 20 open reading frame 194 (C20orf194)
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human C20orf194.

Alternative Gene Names

DKFZp434N061

Open Datasheet (PDF)

Target Information

  • Target Protein: chromosome 20 open reading frame 194
  • Target Gene: C20orf194
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LYCNPVNFRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKITSFVDMVRDCSRIGIPYSSQGHLQIFDMFVVEKWPIVQAFALEGIGGDGFFTMKYELQDVSLN

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000021237 98%
Mouse ENSMUSG00000027309 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.