CacheBy
Atlas Antibodies Anti-C1S Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1S Antibody

상품 한눈에 보기

Human C1S 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018852-100 Anti-C1S Antibody, complement component 1, s subcomponent 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018852-25 Anti-C1S Antibody, complement component 1, s subcomponent 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1S Antibody

Anti-C1S Antibody

Target: Complement component 1, s subcomponent
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human C1S
Open Datasheet


Target Information

항목 내용
Target Protein Complement component 1, s subcomponent
Target Gene C1S
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000011971 (63%), Mouse ENSMUSG00000079343 (61%)

Antigen Sequence (AA):
AAHVVEGNREPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.