CacheBy
Atlas Antibodies Anti-C20orf144 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C20orf144 Antibody

상품 한눈에 보기

사람 C20orf144 단백질을 인식하는 토끼 폴리클로날 항체. IHC를 통한 단백질 발현의 정교한 직교 검증 수행. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며 RNA-seq 데이터 기반 검증 완료.

카탈로그번호
HPA019029-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019029-100 Anti-C20orf144 Antibody, chromosome 20 open reading frame 144 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019029-25 Anti-C20orf144 Antibody, chromosome 20 open reading frame 144 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C20orf144 Antibody

Anti-C20orf144 Antibody

Target: chromosome 20 open reading frame 144 (C20orf144)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C20orf144.


Alternative Gene Names

bclt, dJ63M2.6

Open Datasheet


Specifications

항목 내용
Target Protein chromosome 20 open reading frame 144
Target Gene C20orf144
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MGNYSSHKRTKAPKQARKERPADMDKAWWKSFLNHLTRKKPATRIVLILPLDKRQPLANAGQRIDYASGAGLGS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000038523 (46%), Rat ENSRNOG00000016583 (45%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.