CacheBy
Atlas Antibodies Anti-C19orf73 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf73 Antibody

상품 한눈에 보기

인간 C19orf73 단백질에 대한 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 40% 글리세롤 PBS 버퍼에 보존됩니다.

카탈로그번호
HPA062719-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062719-100 Anti-C19orf73 Antibody, chromosome 19 open reading frame 73 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062719-25 Anti-C19orf73 Antibody, chromosome 19 open reading frame 73 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf73 Antibody

Anti-C19orf73 Antibody

Target: Chromosome 19 open reading frame 73 (C19orf73)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C19orf73.

Alternative Gene Names

  • FLJ10490

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Chromosome 19 open reading frame 73
Target Gene C19orf73
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000033256 35%
Rat ENSRNOG00000021041 33%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.