CacheBy
Atlas Antibodies Anti-C19orf84 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf84 Antibody

상품 한눈에 보기

Human C19orf84 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 고순도와 높은 특이성을 제공합니다. Human에 대해 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA068082-100 Anti-C19orf84 Antibody, chromosome 19 open reading frame 84 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068082-25 Anti-C19orf84 Antibody, chromosome 19 open reading frame 84 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf84 Antibody

Anti-C19orf84 Antibody

Target: chromosome 19 open reading frame 84 (C19orf84)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human C19orf84.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 19 open reading frame 84
Target Gene C19orf84
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000093639 (67%)
  • Rat ENSRNOG00000010881 (29%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.