CacheBy
Atlas Antibodies Anti-C19orf54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf54 Antibody

상품 한눈에 보기

Human C19orf54 단백질에 특이적인 rabbit polyclonal antibody로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 인간 특이성과 신뢰성 있는 성능을 제공합니다.

카탈로그번호
HPA059043-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059043-100 Anti-C19orf54 Antibody, chromosome 19 open reading frame 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059043-25 Anti-C19orf54 Antibody, chromosome 19 open reading frame 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf54 Antibody

Anti-C19orf54 Antibody

Target: chromosome 19 open reading frame 54 (C19orf54)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human C19orf54.


Alternative Gene Names

  • FLJ41131

Open Datasheet (PDF)


Target Information

  • Target Protein: chromosome 19 open reading frame 54
  • Target Gene: C19orf54
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CGLVALWMAGTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVL

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000037715 79%
Mouse ENSMUSG00000078786 77%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.