CacheBy
Atlas Antibodies Anti-C19orf48 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C19orf48 Antibody

상품 한눈에 보기

Human C19orf48 단백질을 표적으로 하는 폴리클로날 래빗 IgG 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 40% 글리세롤 PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA042000-100 Anti-C19orf48 Antibody, chromosome 19 open reading frame 48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042000-25 Anti-C19orf48 Antibody, chromosome 19 open reading frame 48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C19orf48 Antibody

Anti-C19orf48 Antibody

Target: chromosome 19 open reading frame 48 (C19orf48)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression)

Recombinant expression validation:
Validated in WB using target protein overexpression.


Product Description

Polyclonal antibody against human C19orf48.


Alternative Gene Names

  • MGC13170

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein chromosome 19 open reading frame 48
Target Gene C19orf48
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019132 (40%), Mouse ENSMUSG00000045411 (40%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes


제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.