Atlas Antibodies Anti-C19orf48 Antibody

상품 한눈에 보기

Human C19orf48 단백질을 표적으로 하는 폴리클로날 래빗 IgG 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 40% 글리세롤 PBS 버퍼에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042000-100 Anti-C19orf48 Antibody, chromosome 19 open reading frame 48 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042000-25 Anti-C19orf48 Antibody, chromosome 19 open reading frame 48 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 19 open reading frame 48 (C19orf48)
Supplier: Atlas Antibodies

Recombinant expression validation:
Validated in WB using target protein overexpression.

Polyclonal antibody against human C19orf48.

항목	내용
Target Protein	chromosome 19 open reading frame 48
Target Gene	C19orf48
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000019132 (40%), Mouse ENSMUSG00000045411 (40%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand