CacheBy
Atlas Antibodies Anti-C17orf98 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C17orf98 Antibody

상품 한눈에 보기

인간 C17orf98 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. 높은 인간 특이성과 라트·마우스 교차 반응성 보유. 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그번호
HPA051696-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051696-100 Anti-C17orf98 Antibody, chromosome 17 open reading frame 98 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051696-25 Anti-C17orf98 Antibody, chromosome 17 open reading frame 98 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C17orf98 Antibody

Anti-C17orf98 Antibody

Target: Chromosome 17 open reading frame 98 (C17orf98)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C17orf98.


Alternative Gene Names

  • LOC388381

Open Datasheet


Target Information

항목 내용
Target Protein Chromosome 17 open reading frame 98
Target Gene C17orf98
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000036888 (72%), Mouse ENSMUSG00000018543 (71%)

Antigen Sequence:
AYLSECRLRLEKGFILDGVAVSTAARAYGRSRPKLWSAIPPYNAQQDYHARSYFQSHVVPPLLRKTDQDHGGTGRDGWI


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.