원본
Atlas Antibodies Anti-C17orf99 Antibody
상품 한눈에 보기
Human C17orf99 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합함. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공하며, 40% 글리세롤 PBS 버퍼에 보존됨.
- 카탈로그번호
- HPA029655-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029655-100 Anti-C17orf99 Antibody, chromosome 17 open reading frame 99 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029655-25 Anti-C17orf99 Antibody, chromosome 17 open reading frame 99 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C17orf99 Antibody
Anti-C17orf99 Antibody
Target: Chromosome 17 open reading frame 99 (C17orf99)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human C17orf99.
Alternative Gene Names
- GLPG464
- UNQ464
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 17 open reading frame 99 |
| Target Gene | C17orf99 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000075302 (26%), Rat ENSRNOG00000054039 (23%) |
Antigen Sequence:
FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.