CacheBy
Atlas Antibodies Anti-C17orf58 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C17orf58 Antibody

상품 한눈에 보기

인체 C17orf58 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 높은 종간 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023036-100 Anti-C17orf58 Antibody, chromosome 17 open reading frame 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023036-25 Anti-C17orf58 Antibody, chromosome 17 open reading frame 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C17orf58 Antibody

Anti-C17orf58 Antibody

Target: chromosome 17 open reading frame 58 (C17orf58)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C17orf58.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 17 open reading frame 58
Target Gene C17orf58
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FRVHMLALDSSSCNKPCPEFKPGSRYIVMGHIYHKRRQLPTALLQVLRGRLRPGDGLLRSSSSYVKRFNRKREGQIQGAIH
Verified Species Reactivity Human
Interspecies Identity Mouse (89%), Rat (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.