CacheBy
Atlas Antibodies Anti-C15orf52 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C15orf52 Antibody

상품 한눈에 보기

Human C15orf52 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 ICC 실험에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 특이성과 재현성을 제공하며 인간 시료에 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040484-100 Anti-C15orf52 Antibody, chromosome 15 open reading frame 52 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040484-25 Anti-C15orf52 Antibody, chromosome 15 open reading frame 52 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C15orf52 Antibody

Anti-C15orf52 Antibody

Target: Chromosome 15 open reading frame 52 (C15orf52)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C15orf52.

Alternative Gene Names

  • FLJ43339

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Chromosome 15 open reading frame 52
Target Gene C15orf52
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (57%, ENSRNOG00000028910), Mouse (57%, ENSMUSG00000045838)

Antigen Sequence:
ARNQGIEGSPGGRVTRSPPTQVAISSDSARKGSWEPWSRPVGEPPEAGWDYAQWKQEREQIDLARLARHRDAQGDWRRPWDLDKAKSTLQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.