CacheBy
Atlas Antibodies Anti-C15orf48 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C15orf48 Antibody

상품 한눈에 보기

인간 C15orf48 단백질을 인식하는 토끼 폴리클로날 항체. IHC 정합 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현 확인. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 마우스 및 랫과 높은 서열 유사성 보유.

카탈로그번호
HPA012943-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012943-100 Anti-C15orf48 Antibody, chromosome 15 open reading frame 48 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012943-25 Anti-C15orf48 Antibody, chromosome 15 open reading frame 48 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C15orf48 Antibody

Anti-C15orf48 Antibody

Target: chromosome 15 open reading frame 48
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C15orf48.


Alternative Gene Names

  • NMES1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 15 open reading frame 48
Target Gene C15orf48
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000110868 (85%), Rat ENSRNOG00000050251 (79%)

Antigen Sequence:
TDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQ


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.